PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009800222.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 546aa    MW: 62644.6 Da    PI: 5.0233
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009800222.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS282.11.6e-861725441374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..sseelaalklfsevsPilk 92 
                     lve Ll+ Ae v ++++ +aq+lL++  + +s++g+p+qRl+ yf +AL+ r++  ++ +++k + +++ +  +    +  +++ + ++  P+ +
  XP_009800222.1 172 LVEYLLASAEKVGQKEFDRAQNLLNECDKSCSKKGNPIQRLVYYFCRALHDRINWeTGRGTSKGIGMKRLAYIEdsLMNLNSSMIAAHQSVPLSQ 266
                     5789**************************************************8789999999966666543332444445555599******* PP

            GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                     +++++  qaI + v ++e+vHiiD++i+ G+QW  L+qaLa+ +  ++  +l++T++     + ++++e t erL +fA++l+++f+fn++++++
  XP_009800222.1 267 VTQFAGVQAIIDHVVESEKVHIIDLEIGSGMQWTILMQALATNQceSSFKHLKLTALCT---KLRHKIEDTCERLMSFAKSLNLSFSFNIVMVED 358
                     *****************************************998767778*******99...57999**************************** PP

            GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                     + +l+ e ++++ +Ea+++  ++ l+r+l+++ +l+    ++++++k+++P+ ++v+e ea+hns+ F++rf+eal +y a+fd+le  + ++++
  XP_009800222.1 359 IMELKQEYFELDDEEAVVIFAQYFLMRMLARPDKLD----ALMRVIKGINPRAMIVIEVEANHNSPVFVDRFVEALFFYGAFFDALEDCMKHDEK 449
                     *****************************6665555....5****************************************************** PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      r+  E e l++ i+ +va+eg+er+ rh +   Wr+ + + G+++v+ls++   qa+l+l++++ +   ++e ++ +l++gWk+ pL s+SaW+
  XP_009800222.1 450 SRTATESEHLNQGIRIIVAAEGEERTIRHVKIDVWRMFFARYGMEEVELSKSSLYQANLVLKNFAcGSSCTLEMNQYCLLIGWKGTPLSSLSAWT 544
                     *****************************************************************9999*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.187146523IPR005202Transcription factor GRAS
PfamPF035145.4E-84172544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MWDSPKLYTI ESTEMDLDLF ASGLGKDQVV EEEQQQQQDE LQLLVDFVSL DDWDFDVVPL  60
QHQSNVEKTF QTKKSYEITE SKKSMETPLP SALKILKDYN NRFRRSKAEN NIISMQTDKS  120
KCKLSTDEIL RLGAEKFIQS FTISREEAYM FSHPFASSFL SLSEDDTRNI ALVEYLLASA  180
EKVGQKEFDR AQNLLNECDK SCSKKGNPIQ RLVYYFCRAL HDRINWETGR GTSKGIGMKR  240
LAYIEDSLMN LNSSMIAAHQ SVPLSQVTQF AGVQAIIDHV VESEKVHIID LEIGSGMQWT  300
ILMQALATNQ CESSFKHLKL TALCTKLRHK IEDTCERLMS FAKSLNLSFS FNIVMVEDIM  360
ELKQEYFELD DEEAVVIFAQ YFLMRMLARP DKLDALMRVI KGINPRAMIV IEVEANHNSP  420
VFVDRFVEAL FFYGAFFDAL EDCMKHDEKS RTATESEHLN QGIRIIVAAE GEERTIRHVK  480
IDVWRMFFAR YGMEEVELSK SSLYQANLVL KNFACGSSCT LEMNQYCLLI GWKGTPLSSL  540
SAWTFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3719554326374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800222.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_016458635.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1CL900.0M1CL90_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000698450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-57RGA-like 2